PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025244-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 155aa    MW: 17718 Da    PI: 6.101
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025244-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB127.83.8e-40999292
                  NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                           r+ d+++Pia ++rim++vlP +ak+++daket+qecvsefi+f+t++a++ c+re r+ti+++d++ a+  lGf  yvepl+v+++k+r
  SMil_00025244-RA_Salv  9 RDPDQYMPIATLTRIMRRVLPDHAKVADDAKETIQECVSEFIAFITTQANEGCHREYRRTITPNDVVSAMDALGFRSYVEPLTVFINKHR 98
                           688**************************************************************************************9 PP

                  NF-YB 92 e 92
                            
  SMil_00025244-RA_Salv 99 A 99
                           6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-378100IPR009072Histone-fold
SuperFamilySSF471132.1E-3012100IPR009072Histone-fold
PfamPF008083.2E-211478IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.0E-114260No hitNo description
PRINTSPR006158.0E-116179No hitNo description
PRINTSPR006158.0E-118098No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDGQGRLKRD PDQYMPIATL TRIMRRVLPD HAKVADDAKE TIQECVSEFI AFITTQANEG  60
CHREYRRTIT PNDVVSAMDA LGFRSYVEPL TVFINKHRAQ DCYPPRLTIH PPPPPAYVPS  120
PPQQQPPYGG NYLELAQTRD YFMGYRGGED FDPFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-32998392NF-YB
4awl_B1e-32998493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-32998493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095575.14e-51PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ9SFD87e-41NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A022RAV01e-47A0A022RAV0_ERYGU; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.1__2386__AT1G21970.13e-40(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.17e-41NF-YB family protein